Neuropeptide PDF 102 CG6496 Protein PDF Neuropeptide PDF is the main transmitter regulating circadian locomotor rhythms. Required to maintain behavioral rhythms under constant conditions by coordinating pacemaker interactions in the circadian system. Ectopic expression induces long periods, while its absence leads to short periods. PDF_DROME Pigment-dispersing factor homolog MARYTYLVALVLLAICCQWGYCGAMAMPDEERYVRKEYNRDLLDWFNNVGVGQFSPGQVATLCRYPLILENSLGPSVPIRKRNSELINSLLSLPKNMNDAGK PDF precursor-related peptide Pdf